PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009783385.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 255aa    MW: 28608.5 Da    PI: 6.8043
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009783385.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_125.62.7e-081832291561
                     HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1  15 eAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                      +A rsR RK++ i+eLe+ v++L+ae  +L  ele l ++   l +
  XP_009783385.1 183 QSAHRSRVRKLQHIAELERTVQALQAEGYELSAELEFLDQQNIILSM 229
                     69**********************************99988765555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.2E-4174233IPR004827Basic-leucine zipper domain
CDDcd147034.32E-15174225No hitNo description
SuperFamilySSF579597.88E-7182226No hitNo description
Gene3DG3DSA:1.20.5.1702.9E-8183227No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MHPSFEISLE MESSNGSSRL KNFSFSNKQL IMDSTSEGSG SGSSHHHRCN SESFLIEEQP  60
SWLDDLLNEP AETLVVHKGH RRSASDTFAY LGAAAERLNT REINNNVNVG GSSINYVSYK  120
DHLTSSVSYD TKPTSAKAAL ELNEKHNREV ISTQNKEGSS ERSNNTQAKH SMSKADAKRA  180
KQQSAHRSRV RKLQHIAELE RTVQALQAEG YELSAELEFL DQQNIILSME NRPDTKWLNL  240
LFRTDHPSAE LLRPA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754501e-57HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009783385.10.0PREDICTED: uncharacterized protein At4g06598-like
TrEMBLM1AJA31e-113M1AJA3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000240031e-112(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114452023
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.22e-21bZIP family protein